TFF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TFF2 Polyclonal antibody, PBS Only (13681-1-PBS)

• 

  WB analysis of human stomach using 13681-1-AP (same clone as 13681-1-PBS)

  human stomach tissue were subjected to SDS PAGE followed by western blot with 13681-1-AP (TFF2 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13681-1-AP (same clone as 13681-1-PBS)

  Human urine tissue were subjected to SDS PAGE followed by western blot with 13681-1-AP (TFF2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human stomach using 13681-1-AP (same clone as 13681-1-PBS)

  human stomach sample were subjected to SDS PAGE followed by western blot with 13681-1-AP (TFF2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse stomach using 13681-1-AP (same clone as 13681-1-PBS)

  IP result of anti-TFF2 (IP:13681-1-AP, 4ug; Detection:13681-1-AP 1:600) with mouse stomach tissue lysate 4000ug. This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 13681-1-AP (same clone as 13681-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 13681-1-AP (TFF2 Antibody) at dilution of 1:1000 (under 10x lens). This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 13681-1-AP (same clone as 13681-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 13681-1-AP (TFF2 Antibody) at dilution of 1:1000 (under 40x lens). This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 13681-1-AP (same clone as 13681-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 13681-1-AP (TFF2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 13681-1-AP (same clone as 13681-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 13681-1-AP (TFF2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 13681-1-AP (same clone as 13681-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 13681-1-AP (TFF2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 13681-1-AP (same clone as 13681-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 13681-1-AP (TFF2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 13681-1-AP (same clone as 13681-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer using 13681-1-AP (TFF2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 13681-1-AP (same clone as 13681-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer using 13681-1-AP (TFF2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse stomach using 13681-1-AP (same clone as 13681-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse stomach tissue using TFF2 antibody (13681-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse stomach using 13681-1-AP (same clone as 13681-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse stomach tissue using TFF2 antibody (13681-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse stomach using 13681-1-AP (same clone as 13681-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse stomach tissue using TFF2 antibody (13681-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13681-1-PBS in a different storage buffer formulation.

TFF2 Polyclonal Antibody for WB, IHC, IF-P, IP, Indirect ELISA

Cat No. 13681-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, Indirect ELISA

Synonyms

SML1, SP, Spasmolysin, Spasmolytic polypeptide, trefoil factor 2

---

Product Information

13681-1-PBS targets TFF2 in WB, IHC, IF-P, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4537

  Product name: Recombinant human TFF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-129 aa of BC032820

  Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY

• Full Name: trefoil factor 2
• Calculated Molecular Weight: 129 aa, 14 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC032820
• Gene Symbol: TFF2
• Gene ID (NCBI): 7032
• RRID: AB_10598321
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03403
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa), secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system. We got a 18-20 kDa band in western botting maybe due to glycosylatation, and mature TFF2 is a 12 kDa protein (PMID: 10716671).