TFPI2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TFPI2 Polyclonal antibody, PBS Only (30689-1-PBS)

• 

  WB analysis using 30689-1-AP (same clone as 30689-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30689-1-AP (TFPI2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30689-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 30689-1-AP (same clone as 30689-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 30689-1-AP (TFPI2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30689-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 30689-1-AP (same clone as 30689-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 30689-1-AP (TFPI2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30689-1-PBS in a different storage buffer formulation.

TFPI2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30689-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Placental protein 5, PP5, REF1, TFPI 2

---

Product Information

30689-1-PBS targets TFPI2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33467

  Product name: Recombinant human TFPI2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 71-190 aa of NM_001271003.1

  Sequence: GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTG

• Full Name: tissue factor pathway inhibitor 2
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27-36 kDa
• GenBank Accession Number: NM_001271003.1
• Gene Symbol: TFPI2
• Gene ID (NCBI): 7980
• RRID: AB_3669750
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48307
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TFPI2 (tissue factor pathway inhibitor 2), also known as PP5. It is expected to be located in extracellular space, and the protein is enriched in the placenta. This gene encodes a member of the Kunitz-type serine proteinase inhibitor family. The protein can inhibit a variety of serine proteases including factor VIIa/tissue factor, factor Xa, plasmin, trypsin, chymotrypsin and plasma kallikrein. This gene has been identified as a tumor suppressor gene in several types of cancer. The molecular weight of TFPI2 is 27 kDa, and it can recognize the band of 36 kDa (PMID: 21421890).