TGFBR2 Monoclonal antibody, PBS Only

• 

  WB analysis using 66636-1-Ig (same clone as 66636-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66636-1-Ig (TGFBR2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66636-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66636-1-Ig (same clone as 66636-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66636-1-Ig (TGFBR2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 66636-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293T using 66636-1-Ig (same clone as 66636-1-PBS)

  WB result of TGFBR2 antibody (66636-1-Ig; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TGFBR2 transfected HEK-293T cells. This data was developed using the same antibody clone with 66636-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 66636-1-Ig (same clone as 66636-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 66636-1-Ig (TGFBR2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66636-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 66636-1-Ig (same clone as 66636-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 66636-1-Ig (TGFBR2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66636-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 66636-1-Ig (same clone as 66636-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66636-1-Ig (TGFBR2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66636-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66636-1-Ig (same clone as 66636-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66636-1-Ig (TGFBR2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66636-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66636-1-Ig (same clone as 66636-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66636-1-Ig (TGFBR2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66636-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66636-1-Ig (same clone as 66636-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66636-1-Ig (TGFBR2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66636-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TGFBR2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66636-1-PBS

Clone No.2D5H7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

2D5H7, EC:2.7.11.30, TbetaR-II, TGF beta receptor type 2, TGF-beta receptor type II

---

Product Information

66636-1-PBS targets TGFBR2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25773

  Product name: Recombinant human TGFBR2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 23-166 aa of BC040499

  Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ

• Full Name: transforming growth factor, beta receptor II (70/80kDa)
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 65-80 kDa
• GenBank Accession Number: BC040499
• Gene Symbol: TGFBR2
• Gene ID (NCBI): 7048
• RRID: AB_2881995
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P37173
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TGF beta Receptor II (TGFBR2) is a member of the transforming growth factor-β (TGF-β) superfamily, which are critical regulators of cell proliferation and differentiation, developmental patterning and morphogenesis, and disease pathogenesis (PMID: 10974075). TGFBR2 result in both SMAD4-dependent constraint of proliferation and SMAD4-independent activation of apoptosis (PMID: 29396446). The calculated molecular weight of TGFBR2 is 65 kDa. It has some isoforms with the molecular weight of 70-80 kDa and ~90 kDa after glycosylated.