TGM2 Recombinant monoclonal antibody, PBS Only

TGM2 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), Indirect ELISA
Cat No. 82552-4-PBS
Clone No.242828D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, FC (Intra), Indirect ELISA

242828D3, Erythrocyte transglutaminase, TG(C), TG2, TGase 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82552-4-PBS targets TGM2 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7439

Product name: Recombinant human TGM2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-349 aa of BC003551

Sequence: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQP

Predict reactive species
Full Name transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase)
Calculated Molecular Weight 77 kDa
Observed Molecular Weight 77-80 kDa
GenBank Accession NumberBC003551
Gene Symbol TGM2
Gene ID (NCBI) 7052
ENSEMBL Gene IDENSG00000198959
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21980
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Transglutaminase 2 (TGM2) is a ubiquitous and multifunctional calcium-dependent enzyme belonging to the transglutaminase family. It is best known for its canonical activity of catalyzing the cross-linking of proteins by forming stable ε-(γ-glutamyl)lysine isopeptide bonds, which contributes to extracellular matrix stabilization and wound healing. Beyond this, TGM2 exhibits GTPase activity, allowing it to function as a signaling G-protein in intracellular processes. It is implicated in a wide range of physiological functions, including cell adhesion, proliferation, and apoptosis, as well as pathological conditions such as celiac disease, fibrosis, neurodegenerative disorders, and cancer metastasis, where its dysregulated expression often contributes to disease progression.

Loading...
||
New chat Able
正在加载,请稍候...