TGM2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82552-4-RR (same clone as 82552-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82552-4-RR (TGM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82552-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 82552-4-RR (same clone as 82552-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 82552-4-RR (TGM2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82552-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82552-4-RR

  Biolayer interferometry (BLl) kinetic assays of 82552-4-RR against Human TGM2 were performed. The affinity constant is below 1 pM.

TGM2 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 82552-4-PBS

Clone No.242828D3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

242828D3, Erythrocyte transglutaminase, TG(C), TG2, TGase 2

---

Product Information

82552-4-PBS targets TGM2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7439

  Product name: Recombinant human TGM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-349 aa of BC003551

  Sequence: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNYEASVDSLTFSVVTGPAPSQEAGTKARFPLRDAVEEGDWTATVVDQQDCTLSLQLTTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLFNAWCPADAVYLDSEEERQEYVLTQQGFIYQGSAKFIKNIPWNFGQFEDGILDICLILLDVNPKFLKNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGRWDNNYGDGVSPMSWIGSVDILRRWKNHGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGEIQGDKSEMIWNFHCWVESWMTRPDLQP

• Full Name: transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase)
• Calculated Molecular Weight: 77 kDa
• Observed Molecular Weight: 77-80 kDa
• GenBank Accession Number: BC003551
• Gene Symbol: TGM2
• Gene ID (NCBI): 7052
• ENSEMBL Gene ID: ENSG00000198959
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21980
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transglutaminase 2 (TGM2) is a ubiquitous and multifunctional calcium-dependent enzyme belonging to the transglutaminase family. It is best known for its canonical activity of catalyzing the cross-linking of proteins by forming stable ε-(γ-glutamyl)lysine isopeptide bonds, which contributes to extracellular matrix stabilization and wound healing. Beyond this, TGM2 exhibits GTPase activity, allowing it to function as a signaling G-protein in intracellular processes. It is implicated in a wide range of physiological functions, including cell adhesion, proliferation, and apoptosis, as well as pathological conditions such as celiac disease, fibrosis, neurodegenerative disorders, and cancer metastasis, where its dysregulated expression often contributes to disease progression.