CD141/Thrombomodulin Monoclonal antibody, PBS Only

• 

  WB analysis using 67831-1-Ig (same clone as 67831-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67831-1-Ig (Thrombomodulin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Lamin B1 Monoclonal antibody (HRP-66095) as loading control. This data was developed using the same antibody clone with 67831-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 67831-1-Ig (same clone as 67831-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67831-1-Ig (THBD antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67831-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67831-1-Ig (same clone as 67831-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67831-1-Ig (Thrombomodulin antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67831-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67831-1-Ig (same clone as 67831-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67831-1-Ig (Thrombomodulin antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67831-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 67831-1-Ig (same clone as 67831-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67831-1-Ig (CD141/Thrombomodulin antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67831-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 67831-1-Ig (same clone as 67831-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67831-1-Ig (CD141/Thrombomodulin antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67831-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 67831-1-Ig (same clone as 67831-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 67831-1-Ig (CD141/Thrombomodulin antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67831-1-PBS in a different storage buffer formulation.

CD141/Thrombomodulin Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67831-1-PBS

Clone No.5A4C5

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

THBD, Thrombomodulin, THRM, Fetomodulin, CD141

---

Product Information

67831-1-PBS targets CD141/Thrombomodulin in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5723

  Product name: Recombinant human THBD protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 18-350 aa of BC035602

  Sequence: PAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECH

• Full Name: thrombomodulin
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC035602
• Gene Symbol: THBD
• Gene ID (NCBI): 7056
• RRID: AB_2918593
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07204
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Thrombomodulin, also known as THBD and CD141, is an endothelial cell surface glycoprotein that forms a 1:1 complex with the coagulation factor thrombin and plays an important role as a natural anticoagulant. Thrombomodulin serves to convert thrombin from a procoagulant protein into the activator for protein C. Once converted to activated protein C (APC), this protein serves as a major anticoagulant in blood (PMID: 2827310). Thrombomodulin is also located in other cells (keratinocytes, osteoblasts, macrophages,...) where it might be involved in cell differentiation or in inflammation (PMID: 9814688). In humans, thrombomodulin is encoded by the THBD gene. Mutations in this gene are a cause of thromboembolic disease, also known as inherited thrombophilia. Thrombomodulin is glycosylated and has an apparent molecular weight of 75 to 110 kDa (PMID: 1650405; 2827310).