• Featured Product
  • KD/KO Validated

CD141/Thrombomodulin Monoclonal antibody

CD141/Thrombomodulin Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67831-1-Ig
Clone No.5A4C5

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, ELISA

THBD, Thrombomodulin, 5A4C5, CD141, Fetomodulin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, human placenta tissue, THP-1 cells, HUVEC cells
Positive IHC detected inhuman lung cancer tissue, human placenta tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67831-1-Ig targets CD141/Thrombomodulin in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5723

Product name: Recombinant human THBD protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 18-350 aa of BC035602

Sequence: PAPAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPLGLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQRCVNTQGGFECH

Predict reactive species
Full Name thrombomodulin
Calculated Molecular Weight 60 kDa
Observed Molecular Weight105 kDa
GenBank Accession NumberBC035602
Gene Symbol THBD
Gene ID (NCBI) 7056
RRIDAB_2918593
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP07204
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Thrombomodulin, also known as THBD and CD141, is an endothelial cell surface glycoprotein that forms a 1:1 complex with the coagulation factor thrombin and plays an important role as a natural anticoagulant. Thrombomodulin serves to convert thrombin from a procoagulant protein into the activator for protein C. Once converted to activated protein C (APC), this protein serves as a major anticoagulant in blood (PMID: 2827310). Thrombomodulin is also located in other cells (keratinocytes, osteoblasts, macrophages,...) where it might be involved in cell differentiation or in inflammation (PMID: 9814688). In humans, thrombomodulin is encoded by the THBD gene. Mutations in this gene are a cause of thromboembolic disease, also known as inherited thrombophilia. Thrombomodulin is glycosylated and has an apparent molecular weight of 75 to 110 kDa (PMID: 1650405; 2827310).

Protocols

Product Specific Protocols
IHC protocol for CD141/Thrombomodulin antibody 67831-1-IgDownload protocol
WB protocol for CD141/Thrombomodulin antibody 67831-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...