THSD4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• THSD4 Polyclonal antibody, PBS Only (20619-1-PBS)

• 

  IHC staining of human oesophagus cancer using 20619-1-AP (same clone as 20619-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 20619-1-AP (THSD4 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20619-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 20619-1-AP (same clone as 20619-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 20619-1-AP (THSD4 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20619-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 20619-1-AP (same clone as 20619-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 20619-1-AP (THSD4 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20619-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 20619-1-AP (same clone as 20619-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 20619-1-AP (THSD4 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20619-1-PBS in a different storage buffer formulation.

THSD4 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 20619-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

20619-1-PBS targets THSD4 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14682

  Product name: Recombinant human THSD4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 669-1018 aa of BC008840

  Sequence: SAQTFPVRHPDRFSPHRPDNLVPPAPQPPRRSRDHNWKQLGTTECSTTCGKGSQYPIFRCVHRSTHEEAPESYCDSSMKPTPEEEPCNIFPCPAFWDIGEWSECSKTCGLGMQHRQVLCRQVYANRSLTVQPYRCQHLEKPETTSTCQLKICSEWQIRTDWTSCSVPCGVGQRTRDVKCVSNIGDVVDDEECNMKLRPNDIENCDMGPCAKSWFLTEWSERCSAECGAGVRTRSVVCMTNHVSSLPLEGCGNNRPAEATPCDNGPCTGKVEWFAGSWSQCSIECGSGTQQREVICVRKNADTFEVLDPSECSFLEKPPSQQSCHLKPCGAKWFSTEWSMSLQRAMLTRPS

• Full Name: thrombospondin, type I, domain containing 4
• Calculated Molecular Weight: 490 aa, 55 kDa
• GenBank Accession Number: BC008840
• Gene Symbol: THSD4
• Gene ID (NCBI): 79875
• RRID: AB_2878709
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q6ZMP0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.