THUMPD2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• THUMPD2 Polyclonal antibody, PBS Only (21054-1-PBS)

• 

  WB analysis using 21054-1-AP (same clone as 21054-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21054-1-AP (THUMPD2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21054-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 21054-1-AP (same clone as 21054-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using THUMPD2 antibody (21054-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 21054-1-PBS in a different storage buffer formulation.

THUMPD2 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 21054-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

THUMP domain-containing protein 2, THUMP domain containing 2, C2orf8

---

Product Information

21054-1-PBS targets THUMPD2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13736

  Product name: Recombinant human THUMPD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 125-473 aa of BC004163

  Sequence: IEENRDCQLEKQIKEETLEQRDFTTKSEKFQEEEFQNDIEKAIDTHNQNDLTFRVSCRCSGTIGKAFTAQEVGKVIGIAIMKHFGWKADLRNPQLEIFIHLNDIYSVVGIPVFRVSLASRAYIKTAGLRSTIAWAMASLADIKAGAFVLDPMCGLGTILLEAAKEWPDVYYVGADVSDSQLLGTWDNLKAAGLEDKIELLKISVIELPLPSESVDIIISDIPFGKKFKLGKDIKSILQEMERVLHVGGTIVLLLSEDHHRRLTDCKESNIPFNSKDSHTDEPGIKKCLNPEEKTGAFKTASTSFEASNHKFLDRMSPFGSLVPVECYKVSLGKTDAFICKYKKSHSSGL

• Full Name: THUMP domain containing 2
• Calculated Molecular Weight: 473 aa, 53 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC004163
• Gene Symbol: THUMPD2
• Gene ID (NCBI): 80745
• RRID: AB_3085634
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BTF0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

THUMP domain-containing protein 2 (THUMPD2) is the methyltransferase, which interacts with an auxiliary protein, TRMT112, to catalyze U6 m2G72 formation. Western blot analysis detected THUMPD2 at an apparent molecular mass of 56 kDa.