TIAM1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TIAM1 Polyclonal antibody, PBS Only (27694-1-PBS)

• 

  WB analysis using 27694-1-AP (same clone as 27694-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27694-1-AP (TIAM1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27694-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27694-1-AP (same clone as 27694-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27694-1-AP (TIAM1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27694-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HCT 116 using 27694-1-AP (same clone as 27694-1-PBS)

  HCT 116 cells were subjected to SDS PAGE followed by western blot with 27694-1-AP (TIAM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27694-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27694-1-AP (same clone as 27694-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27694-1-AP (TIAM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27694-1-PBS in a different storage buffer formulation.

TIAM1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27694-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

27694-1-PBS targets TIAM1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26777

  Product name: Recombinant human TIAM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 823-1002 aa of NM_003253

  Sequence: MQPEEDIYELLYKEIEICPKVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSMLKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTSNPGHSLCSEQGSSAETAPEETEGPDLESSDETDHSSKSTEQV

• Full Name: T-cell lymphoma invasion and metastasis 1
• Calculated Molecular Weight: 178 kDa
• Observed Molecular Weight: 178 kDa
• GenBank Accession Number: NM_003253
• Gene Symbol: TIAM1
• Gene ID (NCBI): 7074
• RRID: AB_2918127
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13009
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.