TIGD5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TIGD5 Polyclonal antibody, PBS Only (13644-1-PBS)

• 

  WB analysis of HeLa using 13644-1-AP (same clone as 13644-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 13644-1-AP (TIGD5 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13644-1-PBS in a different storage buffer formulation.

TIGD5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13644-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13644-1-PBS targets TIGD5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4590

  Product name: Recombinant human TIGD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-274 aa of BC032632

  Sequence: MPALDSEDAPVRCRPEPLGPPEELQTPDGAVRVLFLSKGSSRAHIPAPLEQGVVAAFKQLYKRELLRLAVSCASGSPLDFMRSFMLKDMLYLAGLSWDLVQAGSIERCWLLGLRAAFEPRPGEDSAGQPAQAEEAAEHSRVLSDLTHLAALAYKCLAPEEVAEWLHLDDDGGPPEGCREEVGPALPPAAPPAPASLPSAIGGGEDEEEATDYGGTSVPTAGEAVRGLETALRWLENQDPREVGPLRLVQLRSLISMARRLGGIWHTPAGPYDGV

• Full Name: tigger transposable element derived 5
• Calculated Molecular Weight: 593 aa, 65 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC032632
• Gene Symbol: TIGD5
• Gene ID (NCBI): 84948
• RRID: AB_2271647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53EQ6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.