TIMM13 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TIMM13 Polyclonal antibody, PBS Only (11973-1-PBS)

• 

  WB analysis using 11973-1-AP (same clone as 11973-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11973-1-AP (TIMM13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11973-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 11973-1-AP (same clone as 11973-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11973-1-AP (TIMM13 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11973-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 11973-1-AP (same clone as 11973-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11973-1-AP (TIMM13 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11973-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 11973-1-AP (same clone as 11973-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 11973-1-AP (TIMM13 antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11973-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 11973-1-AP (same clone as 11973-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 11973-1-AP (TIMM13 antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11973-1-PBS in a different storage buffer formulation.

TIMM13 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11973-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

11973-1-PBS targets TIMM13 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2596

  Product name: Recombinant human TIMM13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-95 aa of BC008607

  Sequence: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM

• Full Name: translocase of inner mitochondrial membrane 13 homolog (yeast)
• Calculated Molecular Weight: 95 aa, 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC008607
• Gene Symbol: TIMM13
• Gene ID (NCBI): 26517
• RRID: AB_2287228
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5L4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TIMM13 gene, also known as TIM13, TIM13B, TIM M13A or TIMM13B, encodes mitochondrial import inner membrane translocase subunit Tim13 belonging to the small Tim family. TIM13 functions as mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Proteins of the intermembrane space (IMS) of mitochondria are typically synthesized without presequences. TIM13 contains four conserved cysteine residues that bind a zinc ion as cofactor. Import of TIM13 did not depend on the membrane potential or ATP hydrolysis. Upon import into mitochondria TIM13 adopted a stably folded conformation in the IMS.