Tested Applications
| Positive WB detected in | HepG2 cells, MCF-7 cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14927-1-AP targets TIM22 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6689 Product name: Recombinant human TIMM22 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC002324 Sequence: MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR Predict reactive species |
| Full Name | translocase of inner mitochondrial membrane 22 homolog (yeast) |
| Calculated Molecular Weight | 20 kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | BC002324 |
| Gene Symbol | TIM22 |
| Gene ID (NCBI) | 29928 |
| RRID | AB_11183050 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y584 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TIM22 is a translocase localized in mitochondrial inner membrane. It is implicated in import of nuclear-encoded mitochondrial preproteins to the mitochondria. TIM22 is the essential core of protein insertion complex (TIM22 complex) that consists of TIM22, TIM54, TIM18, and TIM12.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TIM22 antibody 14927-1-AP | Download protocol |
| IHC protocol for TIM22 antibody 14927-1-AP | Download protocol |
| IP protocol for TIM22 antibody 14927-1-AP | Download protocol |
| WB protocol for TIM22 antibody 14927-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TIM22 antibody (Cat# 14927-1-AP) has accumulated 39 citations published across 31 journals, including Nature, Nature Medicine, Cell Metabolism, Nature Communications, Molecular Cell, Cell Reports, and Current Biology. Associated research fields encompass mitochondrial protein import and translocation, mitophagy, cardiomyopathy, cancer biology, immunology, metabolic regulation, and neurodegeneration. The antibody was predominantly validated by Western blot in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Nat Med The inhibition of TDP-43 mitochondrial localization blocks its neuronal toxicity.
| ||
Cell Metab Quantitative high-confidence human mitochondrial proteome and its dynamics in cellular context. | ||
Cell Metab DNAJC19, a mitochondrial cochaperone associated with cardiomyopathy, forms a complex with prohibitins to regulate cardiolipin remodeling. | ||
Cell Metab Acylglycerol Kinase Maintains Metabolic State and Immune Responses of CD8+ T Cells. | ||
Cell Stem Cell Disrupting Mitochondrial Copper Distribution Inhibits Leukemic Stem Cell Self-Renewal. |
Reviews
What customers say
All five reviews rate the antibody 4–5 stars. Users report strong performance in Western blot (1:1000) across cardiac tissues, cardiomyocytes, and 293 cells, with clear, correctly sized bands and good sensitivity. For immunofluorescence (1:200), it provides reliable mitochondria inner membrane staining in iPSC-derived motor neurons. Overall, customers describe the antibody as sensitive, specific, and consistently working well for both WB and IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Emilie (Verified Customer) (09-24-2025) | I tested it in Western blot (1:1000) and IF (1:200), and it performed well.
|
Manon (Verified Customer) (09-23-2025) | Good mitochondria inner membrane staining by IF
|
Wenhui (Verified Customer) (01-02-2025) | This antibody is sensitive and can give us good clear signal for WB
|
Wenhui (Verified Customer) (01-02-2025) | This antibody has been working great for us. we can detect bands at correct size for WB.
|
angela (Verified Customer) (12-27-2024) | clear band
 |
