TIMM9 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TIMM9 Polyclonal antibody, PBS Only (11479-1-PBS)

• 

  WB analysis using 11479-1-AP (same clone as 11479-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11479-1-AP (TIMM9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11479-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 11479-1-AP (same clone as 11479-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11479-1-AP (TIMM9 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11479-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 11479-1-AP (same clone as 11479-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11479-1-AP (TIMM9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11479-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 11479-1-AP (same clone as 11479-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11479-1-AP (TIMM9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11479-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 11479-1-AP (same clone as 11479-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11479-1-AP (TIMM9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11479-1-PBS in a different storage buffer formulation.

TIMM9 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11479-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

TIMM9A, TIM9A, TIM9

---

Product Information

11479-1-PBS targets TIMM9 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2050

  Product name: Recombinant human TIMM9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-89 aa of BC020213

  Sequence: MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR

• Full Name: translocase of inner mitochondrial membrane 9 homolog (yeast)
• Calculated Molecular Weight: 89 aa, 10 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC020213
• Gene Symbol: TIMM9
• Gene ID (NCBI): 26520
• RRID: AB_2204698
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5J7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.