Product Information
11479-1-PBS targets TIMM9 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2050 Product name: Recombinant human TIMM9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC020213 Sequence: MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR Predict reactive species |
| Full Name | translocase of inner mitochondrial membrane 9 homolog (yeast) |
| Calculated Molecular Weight | 89 aa, 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC020213 |
| Gene Symbol | TIMM9 |
| Gene ID (NCBI) | 26520 |
| RRID | AB_2204698 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5J7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |









