TIMMDC1 Polyclonal antibody

TIMMDC1 Polyclonal Antibody for WB, ELISA
Cat No. 23622-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

C3orf1, Protein M5 14, TIMMDC1, Transmembrane protein C3orf1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

23622-1-AP targets TIMMDC1 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20017

Product name: Recombinant human TIMMDC1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-285 aa of BC012341

Sequence: MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFRINVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD

Predict reactive species
Full Name chromosome 3 open reading frame 1
Calculated Molecular Weight 285 aa, 32 kDa
Observed Molecular Weight 32-35 kDa
GenBank Accession NumberBC012341
Gene Symbol TIMMDC1
Gene ID (NCBI) 51300
RRIDAB_2879305
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ9NPL8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
WB protocol for TIMMDC1 antibody 23622-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cancer Res

miR-450a acts as a tumor suppressor in ovarian cancer by regulating energy metabolism.

Authors - Bruna Rodrigues Muys
humanWB

Immunobiology

METTL3 regulates ASMCs proliferation and M2 macrophage polarization via mediating the m6A methylation of TIMMDC1 in asthma

Authors - Shihao Zhang
Loading...
||
New chat Able
正在加载,请稍候...