TIMMDC1 Polyclonal antibody

• 

  WB analysis of A375 using 23622-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 23622-1-AP (TIMMDC1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

TIMMDC1 Polyclonal Antibody for WB, ELISA

Cat No. 23622-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C3orf1, Protein M5 14, TIMMDC1, Transmembrane protein C3orf1

---

Tested Applications

• Positive WB detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

23622-1-AP targets TIMMDC1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20017

  Product name: Recombinant human TIMMDC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-285 aa of BC012341

  Sequence: MEVPPPAPRSFLCRALCLFPRVFAAEAVTADSEVLEERQKRLPYVPEPYYPESGWDRLRELFGKDEQQRISKDLANICKTAATAGIIGWVYGGIPAFIHAKQQYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWGWRTAVFVTIFNTVNTSLNVYRNKDALSHFVIAGAVTGSLFRINVGLRGLVAGGIIGALLGTPVGGLLMAFQKYSGETVQERKQKDRKALHELKLEEWKGRLQVTEHLPEKIESSLQEDEPENDAKKIEALLNLPRNPSVIDKQDKD

• Full Name: chromosome 3 open reading frame 1
• Calculated Molecular Weight: 285 aa, 32 kDa
• Observed Molecular Weight: 32-35 kDa
• GenBank Accession Number: BC012341
• Gene Symbol: TIMMDC1
• Gene ID (NCBI): 51300
• RRID: AB_2879305
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9NPL8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Res; miR-450a acts as a tumor suppressor in ovarian cancer by regulating energy metabolism.; Authors - Bruna Rodrigues Muys
human	WB	Immunobiology; METTL3 regulates ASMCs proliferation and M2 macrophage polarization via mediating the m6A methylation of TIMMDC1 in asthma; Authors - Shihao Zhang