TIPRL Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TIPRL Polyclonal antibody, PBS Only (15933-1-PBS)

• 

  WB analysis using 15933-1-AP (same clone as 15933-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15933-1-AP (TIPRL antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15933-1-PBS in a different storage buffer formulation.

TIPRL Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15933-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

15933-1-PBS targets TIPRL in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8780

  Product name: Recombinant human TIPRL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-178 aa of BC009506

  Sequence: MMIHGFQSSHRDFCFGPWKLTASKTHIMKSADVEKLADELHMPSLPEMMFGDNVLRIQHGSGFGIEFNATDALRCVNNYQGMLKVACAEEWQESRTEGEHSKEVIKPYDWTYTTDYKGTLLGESLKLKVVPTTDHIDTEKLKAREQIKFFEEVLLFEDELHDHGVSSLSVKIPGGGHL

• Full Name: TIP41, TOR signaling pathway regulator-like (S. cerevisiae)
• Calculated Molecular Weight: 178 aa, 20 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC009506
• Gene Symbol: TIPRL
• Gene ID (NCBI): 261726
• RRID: AB_3669227
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75663
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TIPRL, also known as TIP, TIP4, is an inhibitory regulator of protein phosphatase-2A (PP2A) , PP4, and PP6(PMID: 17384681). TIPRL, an evolutionarily conserved protein, plays a critical role in mediating γ-H2AX signal transduction upon DNA damage(PMID: 26717153).