CoraLite® Plus 750-conjugated TLE1 Monoclonal antibody

• 

  WB analysis using CL750-66216

  Various lysates were subjected to SDS PAGE followed by western blot with CL750-66216 (TLE1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

TLE1 Monoclonal Antibody for WB

Cat No. CL750-66216

Clone No.2F2H11

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB

Synonyms

E(Sp1) homolog, ESG, ESG1, GRG1, TLE1

---

Tested Applications

• Positive WB detected in: Jurkat cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL750-66216 targets TLE1 in WB applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21327

  Product name: Recombinant human TLE1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 422-770 aa of BC010100

  Sequence: DPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY

• Full Name: transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila)
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 85-95 kDa
• GenBank Accession Number: BC010100
• Gene Symbol: TLE1
• Gene ID (NCBI): 7088
• RRID: AB_3084890
• Conjugate: CoraLite® Plus 750 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 755 nm / 780 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q04724
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

TLE1 (Transducin-like enhancer protein 1) is a transcriptional corepressor and binds to a number of transcription factors. It can inhibit NF-kappa-B-regulated gene expression and the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES (PMID: 10660609). TLE1 is highly expressed in postnatal brain (PMID: 29758293; 27852056).