TLE4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TLE4 Polyclonal antibody, PBS Only (30959-1-PBS)

• 

  WB analysis using 30959-1-AP (same clone as 30959-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30959-1-AP (TLE4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30959-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 30959-1-AP (same clone as 30959-1-PBS)

  IP result of anti-TLE4 (IP:30959-1-AP, 4ug; Detection:30959-1-AP 1:800) with K-562 cells lysate 1720 ug. This data was developed using the same antibody clone with 30959-1-PBS in a different storage buffer formulation.

TLE4 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 30959-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

GRG4, KIAA1261

---

Product Information

30959-1-PBS targets TLE4 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34006

  Product name: Recombinant human TLE4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 279-408 aa of BC059405

  Sequence: LDKTRLLKKDAPISPASIASSSSTPSSKSKELSLKRDMGKLSETRLSEDEQCTLGLQRWFCRLWFMNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLASSLRTPMAVPCPYPTPFGI

• Full Name: transducin-like enhancer of split 4 (E(sp1) homolog, Drosophila)
• Calculated Molecular Weight: 84 kDa
• Observed Molecular Weight: 76-88 kDa
• GenBank Accession Number: BC059405
• Gene Symbol: TLE4
• Gene ID (NCBI): 7091
• RRID: AB_3742381
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q04727
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TLE4 (Transducin-like enhancer protein 4), also known as GRG4. It is predicted to be located in the nucleus. Tle4 promotes acquisition of corticothalamic identity and blocks emergence of core characteristics of subcerebral/corticospinal projection neuron identity, including gene expression and connectivity. During the first post-natal week, when corticothalamic innervation is ongoing, Tle4 is required to stabilize corticothalamic neuron identity, limiting interference from differentiation programs of developmentally related neuron classes (PMID: 37561632). The molecular weight of TLE4 is 76 kDa.