Talin-2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Talin-2 Polyclonal antibody, PBS Only (31695-1-PBS)

• 

  WB analysis using 31695-1-AP (same clone as 31695-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31695-1-AP (TLN2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31695-1-PBS in a different storage buffer formulation.

Talin-2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31695-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

talin 2, TLN2, ILWEQ, talin, talin1

---

Product Information

31695-1-PBS targets Talin-2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36217

  Product name: Recombinant human TLN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1140-1313 aa of NM_015059

  Sequence: VAASTTDPAAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAERQQRLAQVAKAVSHSLNNCVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVHATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMA

• Full Name: talin 2
• Calculated Molecular Weight: 271kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: NM_015059
• Gene Symbol: TLN2
• Gene ID (NCBI): 83660
• RRID: AB_3670082
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9Y4G6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Talin is a macromolecular cytoskeleton protein located on the extracellular matrix (ECM) that can bind to a variety of adhesion molecules (e.g., integrin, actin, and adhesion kinase).Humans have two Talin genes, TLN1 and TLN2, which encode Talin 1 and Talin 2 proteins respectively. TLN2 has 74% homology with TLN1 .