TLR3/CD283 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TLR3/CD283 Polyclonal antibody, PBS Only (17766-1-PBS)

• 

  IHC staining of human tonsillitis using 17766-1-AP (same clone as 17766-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17766-1-AP (TLR3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17766-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 17766-1-AP (same clone as 17766-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 17766-1-AP (TLR3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17766-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TLR3/CD283 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 17766-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

TLR3, CD283, toll like receptor 3, Toll-like receptor 3

---

Product Information

17766-1-PBS targets TLR3/CD283 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12171

  Product name: Recombinant human TLR3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-348 aa of BC094737

  Sequence: MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDD

• Full Name: toll-like receptor 3
• Calculated Molecular Weight: 904 aa, 104 kDa
• GenBank Accession Number: BC094737
• Gene Symbol: TLR3
• Gene ID (NCBI): 7098
• RRID: AB_2878436
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15455
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TLR3 belongs to the Toll-like receptor family which is important in the innate immune response to pathogens. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. TLR3 is a nucleotide-sensing TLR that is activated by double-stranded RNA. Upon recognition of dsRNA, TLR3 transmits signals via the adaptor protein TICAM-1/TRIF, leading to the induction of type I IFN, cytokine/chemokine production, and dendritic cell (DC) maturation (PMID: 18262679).