Use Able AI chat for product recommendations
  • Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb® APC-Cyanine7 Anti-Human TLR3/CD283 Rabbit Recombinant Antibody

TLR3/CD283 FcZero-rAb® Recombinant Antibody for FC (Intra)

Cat No. AY7-FcA98016
Clone No.230445F1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

TLR3, CD283, toll like receptor 3, Toll-like receptor 3

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inhuman monocyte-derived immature dendritic cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

AY7-FcA98016 targets TLR3/CD283 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34044

Product name: Recombinant human TLR3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 725-904 aa of BC094737

Sequence: FEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH

Predict reactive species
Full Name toll-like receptor 3
Calculated Molecular Weight 904 aa, 104 kDa
GenBank Accession NumberBC094737
Gene Symbol TLR3
Gene ID (NCBI) 7098
Conjugate APC-Cyanine7 Fluorescent Dye
Excitation/Emission Maxima Wavelengths650 nm / 778 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15455
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

TLR3 belongs to the Toll-like receptor family which is important in the innate immune response to pathogens. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. TLR3 is a nucleotide-sensing TLR that is activated by double-stranded RNA. Upon recognition of dsRNA, TLR3 transmits signals via the adaptor protein TICAM-1/TRIF, leading to the induction of type I IFN, cytokine/chemokine production, and dendritic cell (DC) maturation (PMID: 18262679).

Protocols

Product Specific Protocols
FC protocol for APC-Cyanine7 TLR3/CD283 antibody AY7-FcA98016Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...