Use Able AI chat for product recommendations
  • Site-specific conjugation

CoraLite® Plus 488 Anti-Human TLR3/CD283 Rabbit scFv Antibody

TLR3/CD283 Recombinant Antibody for FC (Intra)

Cat No. CL488-SF98016
Clone No.230445F1

Host / Type

Rabbit / scFv

Reactivity

human

Applications

FC (Intra)

TLR3, CD283, toll like receptor 3, Toll-like receptor 3

Formulation:  HEPES, EDTA, CHAPS, Sucrose, Proclin300
HEPES, EDTA, CHAPS, Sucrose, Proclin300
Conjugate:  CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inhuman monocyte-derived immature dendritic cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-SF98016 targets TLR3/CD283 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Type Rabbit / scFv
Class Recombinant
Type Single-chain variable fragment antibody (scFv)
Immunogen

CatNo: Ag34044

Product name: Recombinant human TLR3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 725-904 aa of BC094737

Sequence: FEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH

Predict reactive species
Full Name toll-like receptor 3
Calculated Molecular Weight 904 aa, 104 kDa
GenBank Accession NumberBC094737
Gene Symbol TLR3
Gene ID (NCBI) 7098
RRIDAB_3748002
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
SourceAnti-Human TLR3/CD283 scFv from clone 230445F1, consisting of VH-GGGGS linker-VL (N- to C-terminus), with a His tag at the C-terminus.
FormLiquid
Purification MethodAffinity purification
Storage Buffer 50mM HEPES, 150mM NaCl, 5mM EDTA, 0.1% CHAPS, 10% Sucrose and 0.1% Proclin300, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.

Background Information

TLR3 belongs to the Toll-like receptor family which is important in the innate immune response to pathogens. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. TLR3 is a nucleotide-sensing TLR that is activated by double-stranded RNA. Upon recognition of dsRNA, TLR3 transmits signals via the adaptor protein TICAM-1/TRIF, leading to the induction of type I IFN, cytokine/chemokine production, and dendritic cell (DC) maturation (PMID: 18262679).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 TLR3/CD283 antibody CL488-SF98016Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...