FcZero-rAb® CoraLite® Plus 647 Anti-Mouse TLR4/CD284 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® CoraLite® Plus 647 Anti-Mouse TLR4/CD284 Rabbit Recombinant Antibody (CL647-FcA98018)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

TLR4/CD284 FcZero-rAb^® Recombinant Antibody for FC

Cat No. CL647-FcA98018 Copied!

Clone No. 230463C7

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD284, Tlr4, toll like receptor 4

• 

  FC experiment of mouse peritoneal macrophages using CL647-FcA98018

  1x10^6 mouse peritoneal macrophages were surface stained with FcZero-rAb® CoraLite® Plus 488 Anti-Mouse CD11b, and 0.25 ug CoraLite® Plus 647 Anti-Mouse TLR4/CD284 Rabbit RecAb (CL647-FcA98018, Clone: 230463C7) or 0.25 ug FcZero-rAb® CoraLite® Plus 647 Rabbit IgG Isotype Control Recombinant Antibody (CL647-FcA98136, Clone: 240953C9). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse peritoneal macrophages using CL647-FcA98018

  1x10^6 mouse peritoneal macrophages were surface stained with 0.25 ug CoraLite® Plus 647 Anti-Mouse TLR4/CD284 Rabbit RecAb (CL647-FcA98018, Clone: 230463C7) (red) or 0.25 ug FcZero-rAb® CoraLite® Plus 647 Rabbit IgG Isotype Control Recombinant Antibody (CL647-FcA98136, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TLR4/CD284 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: mouse peritoneal macrophages

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-FcA98018 targets TLR4/CD284 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32998

  Product name: Recombinant mouse Tlr4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 198-395 aa of NM_021297

  Sequence: RENPQVNLSLDMSLNPIDFIQDQAFQGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGEFKDERNLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIVKFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTLDLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGCCSYSDLG

• Full Name: toll-like receptor 4
• Calculated Molecular Weight: 96 kDa
• GenBank Accession Number: NM_021297
• Gene Symbol: Tlr4
• Gene ID (NCBI): 21898
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9QUK6
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

TLR4, also named as CD284, belongs to the Toll-like receptor family. TLR4 interacts with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). TLR4 acts via MYD88, TIRAP and TRAF6, leading to NF-kB activation, cytokine secretion and the inflammatory response. Three alternatively spliced transcript variants that encode different protein isoforms have been described.