TLR6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TLR6 Polyclonal antibody, PBS Only (22240-1-PBS)

• 

  WB analysis of RAW 264.7 using 22240-1-AP (same clone as 22240-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 22240-1-AP (TLR6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22240-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 22240-1-AP (same clone as 22240-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22240-1-AP (TLR6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22240-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 22240-1-AP (same clone as 22240-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 22240-1-AP (TLR6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22240-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 22240-1-AP (same clone as 22240-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 22240-1-AP (TLR6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22240-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 22240-1-AP (same clone as 22240-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 22240-1-AP (TLR6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22240-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-1080 using 22240-1-AP (same clone as 22240-1-PBS)

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 22240-1-AP (TLR6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22240-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TLR6 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 22240-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

CD286, toll like receptor 6, Toll-like receptor 6

---

Product Information

22240-1-PBS targets TLR6 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17686

  Product name: Recombinant human TLR6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 143-383 aa of BC111755

  Sequence: GNLSQLNFLGLSAMKLQKLDLLPIAHLHLSYILLDLRNYYIKENETESLQILNAKTLHLVFHPTSLFAIQVNISVNTLGCLQLTNIKLNDDNCQVFIKFLSELTRGPTLLNFTLNHIETTWKCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHITNQVFLFSQTALYTVFSEMNIMMLTISDTPFIHMLCPHAPSTFKFLNFTQNVFTDSIFEKCSTLVKLETLI

• Full Name: toll-like receptor 6
• Calculated Molecular Weight: 480 aa, 56 kDa
• Observed Molecular Weight: 95-110 kDa
• GenBank Accession Number: BC111755
• Gene Symbol: TLR6
• Gene ID (NCBI): 10333
• RRID: AB_11232032
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2C9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TLR6, also known as CD286, belongs to the Toll-like receptor (TLR) family, which is important in the innate immune response to pathogens. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. TLR6 can form a heterodimer with TLR2. TLR6 and TLR2 are recruited to the macrophage phagosome, where they recognize peptidoglycan, a Gram-positive pathogen component (PMID: 11095740). TLR6 interacts with CD36, following CD36 stimulation by oxLDL or amyloid-beta 42, and forms a heterodimer with TLR4. The trimeric complex is internalized and triggers an inflammatory response.