TM9SF1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TM9SF1 Polyclonal antibody, PBS Only (16893-1-PBS)

• 

  IHC staining of mouse kidney using 16893-1-AP (same clone as 16893-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16893-1-AP (TM9SF1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16893-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 16893-1-AP (same clone as 16893-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16893-1-AP (TM9SF1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16893-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 16893-1-AP (same clone as 16893-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using TM9SF1 antibody (16893-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 16893-1-PBS in a different storage buffer formulation.

TM9SF1 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 16893-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

hMP70, MP70

---

Product Information

16893-1-PBS targets TM9SF1 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10418

  Product name: Recombinant human TM9SF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-238 aa of BC010856

  Sequence: VEGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLGEVLDGDRMAESLYEIRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHSHKIGLWTHLDFHLEFHGDRIIFANVSVRDVKPHSLDGLRPDEFLGLTHTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLS

• Full Name: transmembrane 9 superfamily member 1
• Calculated Molecular Weight: 606 aa, 69 kDa
• GenBank Accession Number: BC010856
• Gene Symbol: TM9SF1
• Gene ID (NCBI): 10548
• RRID: AB_3741896
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15321
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TM9SF1, also known as HMP70 and MP70, is a membrane protein that regulates cell autophagy (PMID: 19029833). TM9SF1 deficiency inhibits the maturation of antibody-secreting plasma cells through the activation of mTOR and inhibition of autophagy. TM9SF1 is associated with the activity of autoimmune diseases such as rheumatoid arthritis (RA) and systemic lupus erythematosus (SLE)(PMID: 39482663).