TM9SF4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TM9SF4 Polyclonal antibody, PBS Only (29520-1-PBS)

• 

  WB analysis using 29520-1-AP (same clone as 29520-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29520-1-AP (TM9SF4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29520-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 29520-1-AP (same clone as 29520-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 29520-1-AP (TM9SF4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29520-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 29520-1-AP (same clone as 29520-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 29520-1-AP (TM9SF4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29520-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 29520-1-AP (same clone as 29520-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 29520-1-AP (TM9SF4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29520-1-PBS in a different storage buffer formulation.

TM9SF4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29520-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

TUCAP1, Tumor cannibalism associated protein 1

---

Product Information

29520-1-PBS targets TM9SF4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31253

  Product name: Recombinant human TM9SF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 110-210 aa of BC021107

  Sequence: EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVIPQSIRLEDLKADEKSSC

• Full Name: transmembrane 9 superfamily protein member 4
• Calculated Molecular Weight: 642 aa, 75 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC021107
• Gene Symbol: TM9SF4
• Gene ID (NCBI): 9777
• RRID: AB_3086139
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92544
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.