TMCO2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMCO2 Polyclonal antibody, PBS Only (33338-1-PBS)

• 

  WB analysis using 33338-1-AP (same clone as 33338-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33338-1-AP (TMCO2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33338-1-PBS in a different storage buffer formulation.

TMCO2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33338-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Transmembrane and coiled-coil domain-containing protein 2

---

Product Information

33338-1-PBS targets TMCO2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37348

  Product name: Recombinant human TMCO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 72-182 aa of NM_001008740.3

  Sequence: KRSIQSIQKTLLFVITLYKLYKKGSHIFEALLANPEGSGLRIQDNNNLFLSLGLQEKILKKLKTVENKMKNLEGIIVAQKPATKRDCSSEPYCSCSDCQSPLSTSGFTSPI

• Full Name: transmembrane and coiled-coil domains 2
• Calculated Molecular Weight: 20kDa，182aa
• Observed Molecular Weight: 20-25 kDa
• GenBank Accession Number: NM_001008740.3
• Gene Symbol: TMCO2
• Gene ID (NCBI): 127391
• RRID: AB_3742945
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z6W1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.