TMED3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMED3 Polyclonal antibody, PBS Only (21902-1-PBS)

• 

  WB analysis using 21902-1-AP (same clone as 21902-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21902-1-AP (TMED3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21902-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 21902-1-AP (same clone as 21902-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 21902-1-AP (TMED3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21902-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HT-1080 using 21902-1-AP (same clone as 21902-1-PBS)

  HT-1080 cells were subjected to SDS PAGE followed by western blot with 21902-1-AP (TMED3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21902-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 21902-1-AP (same clone as 21902-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 21902-1-AP (TMED3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21902-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse small intestine using 21902-1-AP (same clone as 21902-1-PBS)

  mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 21902-1-AP (TMED3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21902-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skin using 21902-1-AP (same clone as 21902-1-PBS)

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 21902-1-AP (TMED3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21902-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 21902-1-AP (same clone as 21902-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 21902-1-AP (TMED3 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21902-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TMED3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 21902-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Transmembrane emp24 domain-containing protein 3, p26, p24gamma4, p24 family protein gamma-4, Membrane protein p24B

---

Product Information

21902-1-PBS targets TMED3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14032

  Product name: Recombinant human TMED3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-201 aa of BC000027

  Sequence: MGSTVPRSASVLLLLLLLRRAEQPCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLL

• Full Name: transmembrane emp24 protein transport domain containing 3
• Calculated Molecular Weight: 217 aa, 25 kDa
• Observed Molecular Weight: 21-25 kDa
• GenBank Accession Number: BC000027
• Gene Symbol: TMED3
• Gene ID (NCBI): 23423
• RRID: AB_10897159
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3Q3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.