TMED5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMED5 Polyclonal antibody, PBS Only (30393-1-PBS)

• 

  WB analysis using 30393-1-AP (same clone as 30393-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30393-1-AP (TMED5 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30393-1-PBS in a different storage buffer formulation.

TMED5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30393-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

30393-1-PBS targets TMED5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33253

  Product name: Recombinant human TMED5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 120-178 aa of BC070051

  Sequence: IFFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQILLR

• Full Name: transmembrane emp24 protein transport domain containing 5
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC070051
• Gene Symbol: TMED5
• Gene ID (NCBI): 50999
• RRID: AB_3086307
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3A6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMED5 ( transmembrane p24 trafficking protein 5) is highly expressed in cervical and bladder cancer cell lines. TMED5 promotes nuclear autophagy and the malignant behavior of cervical cancer cells (PMID:36530030). Moreover, TMED5 could interact with WNT7B and thus activate the canonical WNT-CTNNB1/β-catenin signaling pathway (PMID:30394198).