TMED9 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMED9 Polyclonal antibody, PBS Only (21620-1-PBS)

• 

  WB analysis using 21620-1-AP (same clone as 21620-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21620-1-AP (TMED9 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21620-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 21620-1-AP (same clone as 21620-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 21620-1-AP (TMED9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21620-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig liver using 21620-1-AP (same clone as 21620-1-PBS)

  pig liver tissue were subjected to SDS PAGE followed by western blot with 21620-1-AP (TMED9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21620-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 21620-1-AP (same clone as 21620-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21620-1-AP (TMED9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21620-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 21620-1-AP (same clone as 21620-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21620-1-AP (TMED9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21620-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 21620-1-AP (same clone as 21620-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21620-1-AP (TMED9 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21620-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 21620-1-AP (same clone as 21620-1-PBS)

  IP result of anti-TMED9 (IP:21620-1-AP, 4ug; Detection:21620-1-AP 1:4000) with HepG2 cells lysate 1600 ug. This data was developed using the same antibody clone with 21620-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 21620-1-AP (same clone as 21620-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 21620-1-AP (TMED9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21620-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 21620-1-AP (same clone as 21620-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 21620-1-AP (TMED9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21620-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 21620-1-AP (same clone as 21620-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 21620-1-AP (TMED9 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 21620-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 21620-1-AP (same clone as 21620-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using TMED9 antibody (21620-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 21620-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 21620-1-AP (same clone as 21620-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using TMED9 antibody (21620-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 21620-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TMED9 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 21620-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Glycoprotein 25L2, GMP25, GP25L2, p24 family protein alpha-2, p24alpha2

---

Product Information

21620-1-PBS targets TMED9 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13813

  Product name: Recombinant human TMED9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-224 aa of BC001123

  Sequence: MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRH

• Full Name: transmembrane emp24 protein transport domain containing 9
• Calculated Molecular Weight: 235 aa, 27 kDa
• Observed Molecular Weight: 24-27 kDa
• GenBank Accession Number: BC001123
• Gene Symbol: TMED9
• Gene ID (NCBI): 54732
• RRID: AB_10858623
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BVK6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMED9 (also named as GMP25, GP25L2 or p25) is a member of the EMP24/GP25L family. TMED9 probably forms hetero-oligomeric complexes with TMED7 (p27), TMED2 (p24), and TMED10 (p23) (PMID: 10359607). Located in the endoplasmic reticulum and the Golgi, TMED9 appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway (PMID: 9472029; 10359607).