TMEM106B Monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP50326-1

  Sandwich ELISA standard curve of MP50326-1, Human TMEM106B Monoclonal Matched Antibody Pair - PBS only. 60333-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag21448. 60333-3-PBS was HRP conjugated as the detection antibody. Range: 0.313-20 ng/mL

• 

  Sample test of MP50326-1

  The mean TMEM106B concentration was determined to be 28.61 ng/mL in HeLa cell extract based on a 2.1 mg/mL extract load, 27.06 ng/mL in A549 cell extract based on a 1.5 mg/mL extract load and 19.17 ng/mL in U-251 cell extract based on a 1.4 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP50326-1

  Cytometric bead array standard curve of MP50326-1, TMEM106B Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60333-2-PBS. Detection antibody: 60333-3-PBS. Standard:Ag21448. Range: 0.195-25 ng/mL.

• 

  Cytometric bead array standard curve of MP50326-3

  Cytometric bead array standard curve of MP50326-3, TMEM106B Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60333-2-PBS. Detection antibody: 60333-6-PBS. Standard:Ag21448. Range: 0.781-50 ng/mL.

TMEM106B Monoclonal Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 60333-2-PBS

Clone No.4F3E9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

---

Product Information

60333-2-PBS targets TMEM106B as part of a matched antibody pair:

MP50326-1: 60333-2-PBS capture and 60333-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

MP50326-3: 60333-2-PBS capture and 60333-6-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21448

  Product name: Recombinant human TMEM106B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-46 aa of BC033901

  Sequence: MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVS

• Full Name: transmembrane protein 106B
• Calculated Molecular Weight: 31 kDa
• GenBank Accession Number: BC033901
• Gene Symbol: TMEM106B
• Gene ID (NCBI): 54664
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NUM4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.