Home
Products
Primary Antibodies
TMEM109 Polyclonal antibody, PBS Only (31438-1-PBS)

Filter: AllWBIHCIF-P

WB analysis using 31438-1-AP (same clone as 31438-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 31438-1-AP (TMEM109 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31438-1-PBS in a different storage buffer formulation.
WB analysis using 31438-1-AP (same clone as 31438-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 31438-1-AP (TMEM109 antibody) at dilution of 1:60000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31438-1-PBS in a different storage buffer formulation.
IHC staining of mouse pancreas using 31438-1-AP (same clone as 31438-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 31438-1-AP (TMEM109 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31438-1-PBS in a different storage buffer formulation.
IHC staining of mouse skeletal muscle using 31438-1-AP (same clone as 31438-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 31438-1-AP (TMEM109 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31438-1-PBS in a different storage buffer formulation.
IHC staining of mouse skeletal muscle using 31438-1-AP (same clone as 31438-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 31438-1-AP (TMEM109 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31438-1-PBS in a different storage buffer formulation.
IF Staining of mouse skeletal muscle using 31438-1-AP (same clone as 31438-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using TMEM109 antibody (31438-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31438-1-PBS in a different storage buffer formulation.
IF Staining of mouse skeletal muscle using 31438-1-AP (same clone as 31438-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse skeletal muscle tissue using TMEM109 antibody (31438-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31438-1-PBS in a different storage buffer formulation.

TMEM109 Polyclonal antibody, PBS Only

Name: TMEM109 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 31438-1-PBS

TMEM109 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 31438-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

Mg23, Mitsugumin 23, transmembrane protein 109

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

31438-1-PBS targets TMEM109 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag34866 Product name: Recombinant human TMEM109 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 194-243 aa of BC001309 Sequence: ILYALLSRLTGSRASGAQLEAKVRGLERQVEELRWRQRRAAKGARSVEEE Predict reactive species
Full Name	transmembrane protein 109
Calculated Molecular Weight	26 kDa
Observed Molecular Weight	22 kDa
GenBank Accession Number	BC001309
Gene Symbol	TMEM109
Gene ID (NCBI)	79073
RRID	AB_3669983
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity Purification
UNIPROT ID	Q9BVC6
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

TMEM109, also known as mg23 or mitsugumin-23, is a transmembrane protein localized to the sarcoplasmic/endoplasmic reticulum and nuclear membranes. TMEM109 is a ball-shaped cation channel in the sarcoplasmic reticulum (SR).