TMEM111 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM111 Polyclonal antibody, PBS Only (24645-1-PBS)

• 

  WB analysis using 24645-1-AP (same clone as 24645-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24645-1-AP (TMEM111 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24645-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 24645-1-AP (same clone as 24645-1-PBS)

  WB result of TMEM111 antibody (24645-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TMEM111 transfected HEK-293 cells. This data was developed using the same antibody clone with 24645-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 24645-1-AP (same clone as 24645-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 24645-1-AP (TMEM111 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24645-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 24645-1-AP (same clone as 24645-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 24645-1-AP (TMEM111 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24645-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 24645-1-AP (same clone as 24645-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using TMEM111 antibody (24645-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24645-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TMEM111 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 24645-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

EMC3, POB

---

Product Information

24645-1-PBS targets TMEM111 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18236

  Product name: Recombinant human TMEM111 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 139-261 aa of BC022807

  Sequence: KVPFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAMPADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF

• Full Name: transmembrane protein 111
• Calculated Molecular Weight: 261 aa, 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC022807
• Gene Symbol: TMEM111
• Gene ID (NCBI): 55831
• RRID: AB_3085744
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0I2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM111,also names as EMC3, is part of the endoplasmic reticulum-associated secretory pathway (PMID: 19797678). TMEM111 was required for murine pulmonary surfactant synthesis and lung function at birth (PMID: 29083321). It can be detect a band of 30 kDa.