TMEM119 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP00444-4

  Sandwich ELISA standard curve of MP00444-4, Human TMEM119 Recombinant Matched Antibody Pair - PBS only. 83448-4-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg0796. 83448-3-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.

• 

  Sample test of MP00444-4

  The mean TMEM119 concentration was determined to be 2,998.4 pg/mL in HEK-293 cell extract based on a 1.5 mg/mL extract load and 3,201.6 pg/mL in SH-SY5Y cell extract based on a 1.2 mg/mL extract load.

• 

  Affinity and Kinetic Characterization of 83448-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 83448-3-PBS against Human TMEM119 was performed. The affinity constant is 7.66 nM.

TMEM119 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83448-3-PBS

Clone No.240433D12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

OBIF, Osteoblast induction factor, transmembrane protein 119, UNQ731/PRO1415

---

Product Information

83448-3-PBS targets TMEM119 as part of a matched antibody pair:

MP00444-4: 83448-4-PBS capture and 83448-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0796

  Product name: Recombinant Human TMEM119 protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 118-283 aa of NM_181724.2

  Sequence: TRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQEVQGHGVPVETPEAQEEPCSGVLEGAVVAGEGQGELEGSLLLAQEAQGPVGPPESPCACSSVHPSV

• Full Name: transmembrane protein 119
• Calculated Molecular Weight: 29 kDa
• GenBank Accession Number: NM_181724.2
• Gene Symbol: TMEM119
• Gene ID (NCBI): 338773
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q4V9L6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.