Tested Applications
| Positive FC detected in | SH-SY5Y cells, Transfected CHO-K1 |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) | FC : 0.25 ug per 10^6 cells in a 100 µl suspension |
| This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
98677-3-RR targets TMEM119 in FC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1823 Product name: Recombinant human TMEM119 protein Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-96 aa of NM_181724 Sequence: RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVM Predict reactive species |
| Full Name | transmembrane protein 119 |
| Calculated Molecular Weight | 29 kDa |
| GenBank Accession Number | NM_181724 |
| Gene Symbol | TMEM119 |
| Gene ID (NCBI) | 338773 |
| RRID | AB_3746265 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q4V9L6 |
| Storage Buffer | PBS with 0.09% sodium azide, pH 7.3. |
| Storage Conditions | Store at 2 - 8°C. Stable for one year after shipment. |
Background Information
TMEM119 (Transmembrane Protein 119), also known as OBIF (Osteoblast Induction Factor), is a type I transmembrane protein that serves as a highly specific marker for resident microglia in the central nervous system (CNS). TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TMEM119 antibody 98677-3-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







