Product Information
25078-1-PBS targets TMEM134 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18533 Product name: Recombinant human TMEM134 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 7-124 aa of BC125134 Sequence: QFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVV Predict reactive species |
| Full Name | transmembrane protein 134 |
| Calculated Molecular Weight | 180 aa, 20 kDa |
| Observed Molecular Weight | 22-27 kDa |
| GenBank Accession Number | BC125134 |
| Gene Symbol | TMEM134 |
| Gene ID (NCBI) | 80194 |
| RRID | AB_3669461 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H6X4 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Transmembrane protein 134 is a protein encoded by the TMEM134 gene. TMEM134 is regulated by the promoter GXP50275. TMEM134 is ubiquitously expressed in the majority of human tissues.





