TMEM134 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM134 Polyclonal antibody, PBS Only (25078-1-PBS)

• 

  WB analysis of rat spleen using 25078-1-AP (same clone as 25078-1-PBS)

  rat spleen tissue were subjected to SDS PAGE followed by western blot with 25078-1-AP (TMEM134 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25078-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 25078-1-AP (same clone as 25078-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 25078-1-AP (TMEM134 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25078-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 25078-1-AP (same clone as 25078-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using TMEM134 antibody (25078-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 25078-1-PBS in a different storage buffer formulation.

TMEM134 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 25078-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

transmembrane protein 134

---

Product Information

25078-1-PBS targets TMEM134 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18533

  Product name: Recombinant human TMEM134 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-124 aa of BC125134

  Sequence: QFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVV

• Full Name: transmembrane protein 134
• Calculated Molecular Weight: 180 aa, 20 kDa
• Observed Molecular Weight: 22-27 kDa
• GenBank Accession Number: BC125134
• Gene Symbol: TMEM134
• Gene ID (NCBI): 80194
• RRID: AB_3669461
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6X4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transmembrane protein 134 is a protein encoded by the TMEM134 gene. TMEM134 is regulated by the promoter GXP50275. TMEM134 is ubiquitously expressed in the majority of human tissues.