TMEM135 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM135 Polyclonal antibody, PBS Only (31327-1-PBS)

• 

  WB analysis using 31327-1-AP (same clone as 31327-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31327-1-AP (TMEM135 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31327-1-PBS in a different storage buffer formulation.

TMEM135 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31327-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31327-1-PBS targets TMEM135 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34057

  Product name: Recombinant human TMEM135 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 352-458 aa of BC051462

  Sequence: YLASKLVETMYFKGIEAGKVPYFPHADTIIYSISTAICFQAAVMEVQTLRPSYWKFLLRLTKGKFAVMNRKVLDVFGTGASKHFQDFIPRLDPRYTTVTPELPTEFS

• Full Name: transmembrane protein 135
• Calculated Molecular Weight: 458 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC051462
• Gene Symbol: TMEM135
• Gene ID (NCBI): 65084
• RRID: AB_3669944
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86UB9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM135, also known as PMP52, contains 3 N-terminal transmembrane domains and 4 C-terminal transmembrane domains. TMEM135 is up-regulated in bone marrow-derived mesenchymal stem cells during differentiation into adipocytes compared to osteoblasts(PMID: 18637193).