TMEM143 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM143 Polyclonal antibody, PBS Only (31917-1-PBS)

• 

  WB analysis using 31917-1-AP (same clone as 31917-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31917-1-AP (TMEM143 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31917-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 31917-1-AP (same clone as 31917-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31917-1-AP (TMEM143 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31917-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 31917-1-AP (same clone as 31917-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31917-1-AP (TMEM143 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31917-1-PBS in a different storage buffer formulation.

TMEM143 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 31917-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Transmembrane protein 143, UNQ5922/PRO19813

---

Product Information

31917-1-PBS targets TMEM143 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36277

  Product name: Recombinant human TMEM143 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 51-200 aa of BC016919

  Sequence: MGEYRKMWNPREPRDWAQQYRERFIPFSKEQLLRLLIQEFHSSPAEKAALEAFSAHVDFCTLFHYHQILARLQALYDPINPDRETLDQPSLTDPQRLSNEQEVLRALEPLLAQANFSPLSEDTLAYALVVHHPQDEVQVTVNLDQYVYIH

• Full Name: transmembrane protein 143
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 45-52 kDa
• GenBank Accession Number: BC016919
• Gene Symbol: TMEM143
• Gene ID (NCBI): 55260
• RRID: AB_3670142
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96AN5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transmembrane protein 143 (TMEM143) is a transmembrane protein and a member of the TMEM (Transmembrane) protein family, which is located in mitochondria (PMID: 11256614). It is known that members of the TMEM family play an important role in the development and metastasis of cancer, especially in conveying information between the extracellular environment and cytoplasmic proteins (PMID: 31454669).