TMEM150 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TMEM150 Recombinant monoclonal antibody, PBS Only (87578-1-PBS)

• 

  WB analysis using 87578-1-RR (same clone as 87578-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87578-1-RR (TMEM150 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87578-1-PBS in a different storage buffer formulation.

TMEM150 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87578-1-PBS

Clone No.252959H6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

TM6P1, TMEM150A, Transmembrane protein 150, Transmembrane protein 150A

---

Product Information

87578-1-PBS targets TMEM150 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag36287

  Product name: Recombinant human TMEM150 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 222-271 aa of BC050466

  Sequence: YGTFSYEFGAVSSDTLVAALQPTPGRACKSSGSSSTSTHLNCAPESIAMI

• Full Name: transmembrane protein 150
• Calculated Molecular Weight: 271 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC050466
• Gene Symbol: TMEM150
• Gene ID (NCBI): 129303
• RRID: AB_3745631
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86TG1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transmembrane protein 150 (TMEM150) mediates plasma membrane targeting of PI4K, likely by weakening the interaction between TTC7 and PI4K complex. It modulates PtdIns4P synthesis and is implicated in fasting-triggered catabolism (PMID: 25608530; 24360784).