TMEM150 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 87578-1-RR (same clone as 87578-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87578-1-RR (TMEM150 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87578-1-PBS in a different storage buffer formulation.

TMEM150 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87578-1-PBS

Clone No.252959H6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

TM6P1, TMEM150A, Transmembrane protein 150, Transmembrane protein 150A

---

Product Information

87578-1-PBS targets TMEM150 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag36287

  Product name: Recombinant human TMEM150 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 222-271 aa of BC050466

  Sequence: YGTFSYEFGAVSSDTLVAALQPTPGRACKSSGSSSTSTHLNCAPESIAMI

• Full Name: transmembrane protein 150
• Calculated Molecular Weight: 271 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC050466
• Gene Symbol: TMEM150
• Gene ID (NCBI): 129303
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86TG1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.