TMEM168 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TMEM168 Polyclonal antibody (22527-1-AP)

TMEM168 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 22527-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

Transmembrane protein 168

• 

  WB analysis using 22527-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22527-1-AP (TMEM168 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 22527-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 22527-1-AP (TMEM168 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 22527-1-AP

  IP result of anti-TMEM168 (IP:22527-1-AP, 4ug; Detection:22527-1-AP 1:3000) with mouse brain tissue lysate 2120 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 22527-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis slide using 22527-1-AP (TMEM168 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 22527-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis slide using 22527-1-AP (TMEM168 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TMEM168 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, PC-3 cells, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22527-1-AP targets TMEM168 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18337

  Product name: Recombinant human TMEM168 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 188-428 aa of BC030804

  Sequence: FHELGNCLGGTSVGYAIVIPTNFCSPDGQPTLLPPEHVQELNLRSTGMLNAIQRFFAYHMIETYGCDYSTSGLSFDTLHSKLKAFLELRTVDGPRHDTYILYYSGHTHGTGEWALAGGDTLRLDTLIEWWREKNGSFCSRLIIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAKHWM

• Full Name: transmembrane protein 168
• Calculated Molecular Weight: 697 aa, 80 kDa
• Observed Molecular Weight: 110-130 kDa
• GenBank Accession Number: BC030804
• Gene Symbol: TMEM168
• Gene ID (NCBI): 64418
• RRID: AB_2879118
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9H0V1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Anti-TMEM168 antibody (Cat# 22527-1-AP) has 3 total citations published in Oncology Research, FASEB Journal, and Journal of Biochemistry. Research fields span glioblastoma oncology (Wnt/β-catenin pathway suppression), cardiac electrophysiology, and Brugada syndrome genetics (TMEM168 mutation effects on Nav1.5 surface expression). Applications cited include WB, IF, and IP in human samples.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Oncol Res; Inhibition of proliferation by knockdown of transmembrane (TMEM) 168 in glioblastoma cells via suppression of Wnt/beta-catenin pathway.; Authors - Jie Xu
human	WB,IF	FASEB J; Identification of transmembrane protein 168 mutation in familial Brugada syndrome.; Authors - Akio Shimizu
human	IP, WB	J Biochem; Transmembrane protein 168 mutation reduces cardiomyocyte cell surface expression of Nav1.5 through αB-crystallin intracellular dynamics.; Authors - Le Kim Chi Nguyen