TMEM176B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM176B Polyclonal antibody, PBS Only (19825-1-PBS)

• 

  WB analysis of A549 using 19825-1-AP (same clone as 19825-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 19825-1-AP (TMEM176B Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19825-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 19825-1-AP (same clone as 19825-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 19825-1-AP (TMEM176B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19825-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 19825-1-AP (same clone as 19825-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 19825-1-AP (TMEM176B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19825-1-PBS in a different storage buffer formulation.

TMEM176B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 19825-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

LR8, Protein LR8, Transmembrane protein 176B

---

Product Information

19825-1-PBS targets TMEM176B in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13918

  Product name: Recombinant human TMEM176B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 149-209 aa of BC004358

  Sequence: SFIWQTEPFLYIDTVCDRSDPVFPTTGYRWMRRSQENQWQKEECRAYMQMLRKLFTAIRAL

• Full Name: transmembrane protein 176B
• Calculated Molecular Weight: 270 aa, 29 kDa
• Observed Molecular Weight: 31 kDa, 23 kDa
• GenBank Accession Number: BC004358
• Gene Symbol: TMEM176B
• Gene ID (NCBI): 28959
• RRID: AB_10638313
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3YBM2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM176B (also known as LR8) is a transmembrane protein belongs to the MS4A family of proteins. It may play a role in the process of maturation of dendritic cells. TMEM176B was first discovered in human lung fibroblasts and is associated with human small cell lung carcinoma. Studies suggest that TMEM176B might be involved in cancer and might serve as targets for antiangiogenic therapy of cancer patients (PMID: 24602018, 22244448). There are two isoforms produced by alternative splicing.