TMEM195 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TMEM195 Polyclonal antibody (21355-1-AP)

TMEM195 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21355-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Alkylglycerol monooxygenase, TMEM195, transmembrane protein 195

• 

  WB analysis of HepG2 using 21355-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21355-1-AP (TMEM195 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of L02 using 21355-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 21355-1-AP (TMEM195 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 21355-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 21355-1-AP (TMEM195 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 21355-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 21355-1-AP (TMEM195 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 21355-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 21355-1-AP (TMEM195 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 21355-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 21355-1-AP (TMEM195 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 21355-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 21355-1-AP (TMEM195 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TMEM195 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, L02 cells, MCF-7 cells, mouse liver tissue
• Positive IHC detected in: human liver tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21355-1-AP targets TMEM195 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15774

  Product name: Recombinant human TMEM195 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 132-333 aa of BC108676

  Sequence: HRMAHEVNIMWAGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQFNLLYQFWIHTEVINNLGPLELILNTPSHHRVHHGRNRYCIDKNYAGVLIIWDKIFGTFEAENEKVVYGLTHPINTFEPIKVQFHHLFSIWTTFWATPGFFNKFSVIFKGPGWGPGKPRLGLSEEIPEVTGKEVPFSSSSSQ

• Full Name: transmembrane protein 195
• Calculated Molecular Weight: 445 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC108676
• Gene Symbol: TMEM195
• Gene ID (NCBI): 392636
• RRID: AB_2878845
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZNB7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TMEM195 Polyclonal antibody (Cat# 21355-1-AP) has 3 citations published in Cell Communications and Signaling, Journal of Infectious Diseases, and Human Genetics. The associated research fields include photoreceptor survival and Müller glia biology, visceral leishmaniasis, and neurodevelopmental disorders linked to AGMO variants.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Cell Commun Signal; Interleukin 27-induced photoreceptor survival is associated with suppression of a novel Muller glia subpopulation.; Authors - Laura D. McGee
human	WB	J Infect Dis; Biochemical Characterization of AGMO Variants Implicated in Relapses in Visceral Leishmaniasis.; Authors - Katrin Watschinger
human	WB	Hum Genet; Biallelic variants in AGMO with diminished enzyme activity are associated with a neurodevelopmental disorder.; Authors - Volkan Okur