Product Information
32273-1-PBS targets TMEM205 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15211 Product name: Recombinant human TMEM205 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 100-189 aa of BC064948 Sequence: TVNARWLEPRTTAAMWALQTVEKERGLGGEVPGSHQGPDPYRQLREKDPKYSALRQNFFRYHGLSSLCNLGCVLSNGLCLAGLALEIRSL Predict reactive species |
| Full Name | transmembrane protein 205 |
| Calculated Molecular Weight | 189 aa, 21 kDa |
| Observed Molecular Weight | 21 kDa |
| GenBank Accession Number | BC064948 |
| Gene Symbol | TMEM205 |
| Gene ID (NCBI) | 374882 |
| RRID | AB_3742561 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q6UW68 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
As a member of the transmembrane proteins (TMEMs), TMEM205 constructed transmembrane channels for a variety of substances, mediating communication between the intracellular and extracellular environment (PMID: 38850316).



