TMEM219 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TMEM219 Recombinant monoclonal antibody, PBS Only (88228-1-PBS)

TMEM219 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 88228-1-PBS Copied!

Clone No. 260625G2

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

IGFBP-3R, Insulin-like growth factor-binding protein 3 receptor, Transmembrane protein 219

• 

  WB analysis using 88228-1-RR (same clone as 88228-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88228-1-RR (TMEM219 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88228-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 88228-1-RR (same clone as 88228-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88228-1-RR (TMEM219 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88228-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TMEM219 in ?

Chat with Able

---

Product Information

88228-1-PBS targets TMEM219 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg10278

  Product name: Recombinant human TMEM219 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 39-204 aa of NM_001083613.2

  Sequence: SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSR

• Full Name: transmembrane protein 219
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 26~30 kDa
• GenBank Accession Number: NM_001083613.2
• Gene Symbol: TMEM219
• Gene ID (NCBI): 124446
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86XT9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM219, also known as IGFBP-3R (Insulin-like growth factor-binding protein 3 receptor), is a recently discovered death receptor, which induces cell apoptosis by a Caspase-8-dependent mechanism, through the binding with its ligand, the Insulin-like growth factors binding protein 3 (IGFBP3). TMEM219 was one of the most highly expressed and ranked the third most abundant beta-cell receptor. Increased TMEM219 expression was primarily evident in intestinal cells cultured with inflammatory cytokines and it was associated with higher cell death