Filter:
Tested Applications
| Positive WB detected in | A549 cells, Calu-1 cells, LNCaP cells, U-251 cells, Y79 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
33511-1-AP targets TMEM256 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36789 Product name: Recombinant human C17orf61 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 30-92 aa of BC030270 Sequence: AQFPDAYGKELFDKANKHHFLHSLALLGVPHCRKPLWAGLLLASGTTLFCTSFYYQALSGDPS Predict reactive species |
| Full Name | chromosome 17 open reading frame 61 |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC030270 |
| Gene Symbol | C17orf61 |
| Gene ID (NCBI) | 254863 |
| RRID | AB_3742997 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q8N2U0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM256, also known as C17orf61, is a number of TMEM families, encodes a protein of ~11.7 kDa, TMEM256 is expressed in proximal renal tubular cells, and its subcellular localization is in exosomes (PMID: 39991002).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TMEM256 antibody 33511-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
