TMEM256 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM256 Polyclonal antibody, PBS Only (33511-1-PBS)

• 

  WB analysis using 33511-1-AP (same clone as 33511-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33511-1-AP (TMEM256 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33511-1-PBS in a different storage buffer formulation.

TMEM256 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33511-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C17orf61, Transmembrane protein 256

---

Product Information

33511-1-PBS targets TMEM256 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36789

  Product name: Recombinant human C17orf61 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-92 aa of BC030270

  Sequence: AQFPDAYGKELFDKANKHHFLHSLALLGVPHCRKPLWAGLLLASGTTLFCTSFYYQALSGDPS

• Full Name: chromosome 17 open reading frame 61
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC030270
• Gene Symbol: C17orf61
• Gene ID (NCBI): 254863
• RRID: AB_3742997
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N2U0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM256, also known as C17orf61, is a number of TMEM families, encodes a protein of ~11.7 kDa, TMEM256 is expressed in proximal renal tubular cells, and its subcellular localization is in exosomes (PMID: 39991002).