Product Information
31525-1-PBS targets TMEM258 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35142 Product name: Recombinant human TMEM258 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-54 aa of BC015968 Sequence: MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKEL Predict reactive species |
| Full Name | chromosome 11 open reading frame 10 |
| Observed Molecular Weight | 10 and 16 kDa |
| GenBank Accession Number | BC015968 |
| Gene Symbol | C11orf10 |
| Gene ID (NCBI) | 746 |
| RRID | AB_3742445 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | P61165 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TMEM258, or transmembrane protein 258, is a component of the oligosaccharyltransferase (OST) complex. Research has shown that TMEM258 is involved in controlling ER stress and intestinal inflammation. In particular, it has been identified as a central regulator of intestinal homeostasis. The loss of TMEM258 leads to unresolved ER stress, which can result in apoptosis (PMID: 27974209). The calculated MW is 9 kDa, The observed MW is multiple bands, which may be caused by Glycosylation modification.















