Home
Products
Primary Antibodies
TMEM41B Polyclonal antibody, PBS Only (29270-1-PBS)

Filter: AllWBIHC

WB analysis of HeLa using 29270-1-AP (same clone as 29270-1-PBS)
WB result of TMEM41B antibody (29270-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TMEM41B transfected HeLa cells. This data was developed using the same antibody clone with 29270-1-PBS in a different storage buffer formulation.
WB analysis using 29270-1-AP (same clone as 29270-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 29270-1-AP (TMEM41B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29270-1-PBS in a different storage buffer formulation.
IHC staining of mouse lung using 29270-1-AP (same clone as 29270-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 29270-1-AP (TMEM41B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29270-1-PBS in a different storage buffer formulation.
IHC staining of mouse lung using 29270-1-AP (same clone as 29270-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 29270-1-AP (TMEM41B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29270-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 29270-1-AP (same clone as 29270-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29270-1-AP (TMEM41B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29270-1-PBS in a different storage buffer formulation.
IHC staining of mouse testis using 29270-1-AP (same clone as 29270-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 29270-1-AP (TMEM41B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29270-1-PBS in a different storage buffer formulation.
IHC staining of human lung using 29270-1-AP (same clone as 29270-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 29270-1-AP (TMEM41B antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29270-1-PBS in a different storage buffer formulation.
IHC staining of human lung using 29270-1-AP (same clone as 29270-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 29270-1-AP (TMEM41B antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29270-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

TMEM41B Polyclonal antibody, PBS Only

Name: TMEM41B Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 29270-1-PBS

TMEM41B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29270-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Transmembrane protein 41B, KIAA0033

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

29270-1-PBS targets TMEM41B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag30810 Product name: Recombinant human TMEM41B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC035034 Sequence: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGSARMSLLILVSIFLSAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTF Predict reactive species
Full Name	transmembrane protein 41B
Calculated Molecular Weight	32 kDa
Observed Molecular Weight	22-28 kDa
GenBank Accession Number	BC035034
Gene Symbol	TMEM41B
Gene ID (NCBI)	440026
RRID	AB_2918264
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q5BJD5
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Transmembrane protein 41B (TMEM41B), also known as Stasimon, is a major target of survival motor neuron (SMN)-dependent U12 splicing and has been identified as a protein required for motor circuit function (PMID: 23063131). TMEM41B localizes to the endoplasmic reticulum. It is involved in autophagosome biogenesis and lipid mobilization (PMID: 30126924). TMEM41B has been shown to be essential for mouse embryonic development (PMID: 30352685). Additionally, genome-scale CRISPR knockout screens reveal that TMEM41B is required for infection of flavivirus and coronavirus, including SARS-CoV-2 (PMID: 33052348; 33052332). Alternative splicing results in three transcript variants encoding distinct isoforms.