TMEM45A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM45A Polyclonal antibody, PBS Only (27534-1-PBS)

• 

  WB analysis using 27534-1-AP (same clone as 27534-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27534-1-AP (TMEM45A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27534-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27534-1-AP (same clone as 27534-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27534-1-AP (TMEM45A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27534-1-PBS in a different storage buffer formulation.

TMEM45A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27534-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Dermal papilla-derived protein 7, DERP7, DNA polymerase-transactivated protein 4, DNAPTP4, Transmembrane protein 45A

---

Product Information

27534-1-PBS targets TMEM45A in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24392

  Product name: Recombinant human TMEM45A protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 229-275 aa of BC040355

  Sequence: YAVTIVIVGMNYAFITWLVKSRLKRLCSSEVGLLKNAEREQESEEEM

• Full Name: transmembrane protein 45A
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC040355
• Gene Symbol: TMEM45A
• Gene ID (NCBI): 55076
• RRID: AB_3669609
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NWC5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM45A, also known as DERP7, DNAPTP4, or FLJ10134, is a transmembrane protein belonging to the TMEM family. TMEM45A is highly expressed in keratinocytes and its expression correlates with keratinization, suggesting a role in normal epidermal physiology(PMID: 22954140; PMID: 24689342). TMEM45A promotes cell proliferation, migration, and invasion in glioblastoma cells, favors epithelial-mesenchymal transition (EMT) in colorectal cancer and promotes cell proliferation by favoring the G1/S cell cycle transition in ovarian cancer cells (PMID: 37936608). The predicted molecular weight of TMEM45A is 32 kDa, and 66-98 kDa has been reported in the literature(PMID: 22954140).