TMEM63C Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM63C Polyclonal antibody, PBS Only (23115-1-PBS)

• 

  WB analysis using 23115-1-AP (same clone as 23115-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 23115-1-AP (TMEM63C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23115-1-PBS in a different storage buffer formulation.

TMEM63C Polyclonal Antibody for WB, Indirect ELISA

Cat No. 23115-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

23115-1-PBS targets TMEM63C in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19428

  Product name: Recombinant human TMEM63C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 693-806 aa of BC136613

  Sequence: LLIAMVIAFVGIFLGKLRMVADYEPEEEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTMNNQPEEGEEESGLRGFARELDSAQFQEGLELEGQNQYH

• Full Name: transmembrane protein 63C
• Calculated Molecular Weight: 806 aa, 93 kDa
• Observed Molecular Weight: 93 kDa
• GenBank Accession Number: BC136613
• Gene Symbol: TMEM63C
• Gene ID (NCBI): 57156
• RRID: AB_3085706
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9P1W3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM63C, also known as CSC1, is a member of the TMEM family. TMEM63C is expressed in kidney and associated with podocyte function (PMID: 32750436). Patients with focal segmental glomerulosclerosis exhibited specific TMEM63C loss in podocytes.