TMEM71 Polyclonal antibody

• 

  IHC staining of human prostate cancer using 16722-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 16722-1-AP (TMEM71 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human prostate cancer using 16722-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 16722-1-AP (TMEM71 Antibody) at dilution of 1:50 (under 40x lens).

TMEM71 Polyclonal Antibody for IHC, ELISA

Cat No. 16722-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

TMEM71, transmembrane protein 71

---

Tested Applications

• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

16722-1-AP targets TMEM71 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10161

  Product name: Recombinant human TMEM71 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of BC105783

  Sequence: MYRISQLMSTPVASSSRLEREYAGELSPTCIFPSFTCDSLDGYHSFECGSIDPLTGSHYTCRRSPRLLTNGYYIWTEDSFLCDKDGNITLNPSQTSVMYKENLVRIFRKKKRICHSFSSLFNLSTSKSWLHGSIFGDINSSPSEDNWLKGTRRLDTDHCNGNETRLL

• Full Name: transmembrane protein 71
• Calculated Molecular Weight: 232 aa, 26 kDa
• GenBank Accession Number: BC105783
• Gene Symbol: TMEM71
• Gene ID (NCBI): 137835
• RRID: AB_2878304
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P5X7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM71 is a transmembrane protein which was found to be associated with the glucocorticoids (GC) response status of the Acute Graft-versus-Host Disease (aGvHD) patients.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Hum Cell; Identification and validation of an m6A-related gene signature to predict prognosis and evaluate immune features of breast cancer; Authors - Wenhao Li