TMEM71 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TMEM71 Polyclonal antibody (16722-1-AP)

TMEM71 Polyclonal Antibody for IHC, ELISA

Cat No. 16722-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

TMEM71, transmembrane protein 71

• 

  IHC staining of human prostate cancer using 16722-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 16722-1-AP (TMEM71 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 16722-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 16722-1-AP (TMEM71 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TMEM71 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16722-1-AP targets TMEM71 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10161

  Product name: Recombinant human TMEM71 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of BC105783

  Sequence: MYRISQLMSTPVASSSRLEREYAGELSPTCIFPSFTCDSLDGYHSFECGSIDPLTGSHYTCRRSPRLLTNGYYIWTEDSFLCDKDGNITLNPSQTSVMYKENLVRIFRKKKRICHSFSSLFNLSTSKSWLHGSIFGDINSSPSEDNWLKGTRRLDTDHCNGNETRLL

• Full Name: transmembrane protein 71
• Calculated Molecular Weight: 232 aa, 26 kDa
• GenBank Accession Number: BC105783
• Gene Symbol: TMEM71
• Gene ID (NCBI): 137835
• RRID: AB_2878304
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P5X7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM71 is a transmembrane protein which was found to be associated with the glucocorticoids (GC) response status of the Acute Graft-versus-Host Disease (aGvHD) patients.

Publications

What published studies show

The TMEM71 Polyclonal antibody (Cat# 16722-1-AP) has 1 citation. It was published in Human Cell (Impact Factor 2.8) in November 2022. The study focused on identifying and validating an m6A-related gene signature for predicting prognosis and evaluating immune features in breast cancer, using IHC in human samples. The research field encompasses RNA modification (m6A), oncology, and tumor immunology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Hum Cell; Identification and validation of an m6A-related gene signature to predict prognosis and evaluate immune features of breast cancer; Authors - Wenhao Li